(data stored in ACNUC7421 zone)

EMBL: CP000948.PE687

CP000948.PE687       Location/Qualifiers
FT   CDS             726833..727315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeL"
FT                   /locus_tag="ECDH10B_0712"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01865"
FT                   /protein_id="ACB01865.1"
FT                   /translation="MNKVAQYYRELVASLSERLRNGERDIDALVEQARERVIKTGELTR
FT                   TEVDELTRAVRRDLEEFAMSYEESLKEESDSVFMRVIKESLWQELADITDKTQLEWREV
FT                   FQDLNHHGVYHSGEVVGLGNLVCEKCHFHLPIYTPEVLTLCPKCGHDQFQRRPFEP"
     MNKVAQYYRE LVASLSERLR NGERDIDALV EQARERVIKT GELTRTEVDE LTRAVRRDLE        60
     EFAMSYEESL KEESDSVFMR VIKESLWQEL ADITDKTQLE WREVFQDLNH HGVYHSGEVV       120
     GLGNLVCEKC HFHLPIYTPE VLTLCPKCGH DQFQRRPFEP                             160
//

If you have problems or comments...

PBIL Back to PBIL home page