(data stored in ACNUC7421 zone)

EMBL: CP000948.PPDD

CP000948.PPDD        Location/Qualifiers
FT   CDS             complement(91213..91653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppdD"
FT                   /locus_tag="ECDH10B_0088"
FT                   /product="predicted major pilin subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01287"
FT                   /protein_id="ACB01287.1"
FT                   /translation="MDKQRGFTLIELMVVIGIIAILSAIGIPAYQNYLRKAALTDMLQT
FT                   FVPYRTAVELCALEHGGLDTCDGGSNGIPSPTTTRYVSAMSVAKGVVSLTGQESLNGLS
FT                   VVMTPGWDNANGVTGWTRNCNIQSDSALQQACEDVFRFDDAN"
     MDKQRGFTLI ELMVVIGIIA ILSAIGIPAY QNYLRKAALT DMLQTFVPYR TAVELCALEH        60
     GGLDTCDGGS NGIPSPTTTR YVSAMSVAKG VVSLTGQESL NGLSVVMTPG WDNANGVTGW       120
     TRNCNIQSDS ALQQACEDVF RFDDAN                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page