(data stored in ACNUC7421 zone)

EMBL: CP000948.PSIF

CP000948.PSIF        Location/Qualifiers
FT   CDS             341836..342156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psiF"
FT                   /locus_tag="ECDH10B_0341"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01513"
FT                   /protein_id="ACB01513.1"
FT                   /translation="MKITLLVTLLFGLVFLTTVGAAERTLTPQQQRMTSCNQQATAQAL
FT                   KGDARKTYMSDCLKNSKSAPGEKSLTPQQQKMRECNNQATQQSLKGDDRNKFMSACLKK
FT                   AA"
     MKITLLVTLL FGLVFLTTVG AAERTLTPQQ QRMTSCNQQA TAQALKGDAR KTYMSDCLKN        60
     SKSAPGEKSL TPQQQKMREC NNQATQQSLK GDDRNKFMSA CLKKAA                      106
//

If you have problems or comments...

PBIL Back to PBIL home page