(data stored in ACNUC7421 zone)

EMBL: CP000948.QUEC

CP000948.QUEC        Location/Qualifiers
FT   CDS             complement(403407..404102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queC"
FT                   /locus_tag="ECDH10B_0400"
FT                   /product="enzyme in preQ0 biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01572"
FT                   /db_xref="GOA:B1XFN2"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XFN2"
FT                   /protein_id="ACB01572.1"
FT                   /translation="MKRAVVVFSGGQDSTTCLVQALQQYDEVHCVTFDYGQRHRAEIDV
FT                   ARELALKLGARAHKVLDVTLLNELAVSSLTRDSIPVPDYEPEADGIPNTFVPGRNILFL
FT                   TLAAIYAYQVKAEAVITGVCETDFSGYPDCRDEFVKALNHAVSLGMAKDIRFETPLMWI
FT                   DKAETWALADYYGKLDLVRNETLTCYNGFKGDGCGHCAACNLRANGLNHYLADKPTVMA
FT                   AMKQKTGLR"
     MKRAVVVFSG GQDSTTCLVQ ALQQYDEVHC VTFDYGQRHR AEIDVARELA LKLGARAHKV        60
     LDVTLLNELA VSSLTRDSIP VPDYEPEADG IPNTFVPGRN ILFLTLAAIY AYQVKAEAVI       120
     TGVCETDFSG YPDCRDEFVK ALNHAVSLGM AKDIRFETPL MWIDKAETWA LADYYGKLDL       180
     VRNETLTCYN GFKGDGCGHC AACNLRANGL NHYLADKPTV MAAMKQKTGL R                231
//

If you have problems or comments...

PBIL Back to PBIL home page