(data stored in ACNUC7421 zone)

EMBL: CP000948.RCSF

CP000948.RCSF        Location/Qualifiers
FT   CDS             complement(193695..194099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcsF"
FT                   /locus_tag="ECDH10B_0177"
FT                   /product="predicted outer membrane protein, signal"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01375"
FT                   /protein_id="ACB01375.1"
FT                   /translation="MRALPICLVALMLSGCSMLSRSPVEPVQSTAPQPKAEPAKPKAPR
FT                   ATPVRIYTNAEELVGKPFRDLGEVSGDSCQASNQDSPPSIPTARKRMQINASKMKANAV
FT                   LLHSCEVTSGTPGCYRQAVCIGSALNITAK"
     MRALPICLVA LMLSGCSMLS RSPVEPVQST APQPKAEPAK PKAPRATPVR IYTNAEELVG        60
     KPFRDLGEVS GDSCQASNQD SPPSIPTARK RMQINASKMK ANAVLLHSCE VTSGTPGCYR       120
     QAVCIGSALN ITAK                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page