(data stored in ACNUC7421 zone)

EMBL: CP000948.RHSC

CP000948.RHSC        Location/Qualifiers
FT   CDS             781398..785591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhsC"
FT                   /locus_tag="ECDH10B_0767"
FT                   /product="rhsC element core protein RhsC"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0767"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01910"
FT                   /protein_id="ACB01910.1"
FT                   /translation="MSGKPAARQGDMTQYGGSIVQGSAGVRIGAPTGVACSVCPGGVTS
FT                   GHPVNPLLGAKVLPGETDIALPGPLPFILSRTYSSYRTKTPAPVGSLGPGWKMPADIRL
FT                   QLRDNTLILSDNGGRSLYFEHLFPGEDGYSRSESLWLVRGGVAKLDEGHRLAALWQALP
FT                   EELRLSPHRYLATNSPQGPWWLLGWCERVPEADEVLPAPLPPYRVLTGLVDRFGRTQTF
FT                   HREAAGEFSGEITGVTDGAGRHFRLVLTTQAQRAEEARQQAISGGTEPSAFPDTLPGYT
FT                   EYGRDNGIRLSAVWLTHDPEYPENLPAAPLVRYGWTPRGELAAVYDRSNTQVRSFTYDD
FT                   KYRGRMVAHRHTGRPEICYRYDSDGRVTEQLNPAGLSYTYQYEKDRITITDSLNRREVL
FT                   HTQGEGGLKRVVKKEHADGSVTQSQFDAVGRLRAQTDAAGRTTEYSPDVVTGLITRITT
FT                   PDGRASAFYYNHHSQLTSATGPDGLEIRREYDEWGRLIQETAPDGDITRYRYDNPHSDL
FT                   PCATEDATGSRKTMTWSRYGQLLSFTDCSGYVTRYDHDRFGQVTAVHREEGLSQYRAYD
FT                   SRGQLIAVKDTQGHETRYEYNAAGDLTTVIAPDGSRNGTQYDAWGKAICTTQGGLTRSM
FT                   EYDAAGRVIRLTSENGSHTTFRYDVLDRLIQETGFDGRTQRYHHDLTGKLIRSEDEGLV
FT                   THWHYDEADRLTHRTVNGETAERWQYDERGWLTDISHISEGHRVTVHYGYDSKGRLASE
FT                   HLTVHHPQTNELLWQHETRHAYNAQGLANRCIPDSLPAVEWLTYGSGWLSGMKLGDTPL
FT                   VEYTRDRLHRETLRSFGRYELTTAYTPAGQLQSQHLNSLLSDRDYTWNDNGELIRISSP
FT                   RQTRSYSYSTTGRLTGVHTTAANLDIRIPYTTDPAGNRLPDPELHPDSALSMWPDNRIA
FT                   RDAHYLYRYDRHGRLTEKTDLIPEGVIRTDDERTHRYHYDSQHRLVHYTRTQYAEPLVE
FT                   SRYLYDPLGRRVAKRVWRRERDLTGWMSLSRKPQVTWYGWDGDRLTTIQNDRTRIQTIY
FT                   QPGSFTPLIRVETATGELAKTQRRSLADTLQQSGGEDGGSVVFPPVLVQMLDRLESEIL
FT                   ADRVSEESRRWLASCGLTVAQMQSQMDPVYTPARKIHLYHCDHRGLPLALISTEGTTAW
FT                   YAEYDEWGNLLNEENPHQLQQLIRLPGQQYDEESGLYYNRHRYYDPLQGRYITQDPIGL
FT                   KGGWNFYQYPLNPISNIDPLGLETLKCIKPLHSMGGTGERSGPDIWGNPFYHQYLCVPD
FT                   GKGDYTCGGQDQRGESKGDGLWGPGKASNDTKEAAGRCDLVETDNSCVENCLKGKFKEV
FT                   RPRYSVLPDIFTPINLGLFKNCQDWSNDSLETCKMKCSGNNIGRFIRFVFTGVM"
     MSGKPAARQG DMTQYGGSIV QGSAGVRIGA PTGVACSVCP GGVTSGHPVN PLLGAKVLPG        60
     ETDIALPGPL PFILSRTYSS YRTKTPAPVG SLGPGWKMPA DIRLQLRDNT LILSDNGGRS       120
     LYFEHLFPGE DGYSRSESLW LVRGGVAKLD EGHRLAALWQ ALPEELRLSP HRYLATNSPQ       180
     GPWWLLGWCE RVPEADEVLP APLPPYRVLT GLVDRFGRTQ TFHREAAGEF SGEITGVTDG       240
     AGRHFRLVLT TQAQRAEEAR QQAISGGTEP SAFPDTLPGY TEYGRDNGIR LSAVWLTHDP       300
     EYPENLPAAP LVRYGWTPRG ELAAVYDRSN TQVRSFTYDD KYRGRMVAHR HTGRPEICYR       360
     YDSDGRVTEQ LNPAGLSYTY QYEKDRITIT DSLNRREVLH TQGEGGLKRV VKKEHADGSV       420
     TQSQFDAVGR LRAQTDAAGR TTEYSPDVVT GLITRITTPD GRASAFYYNH HSQLTSATGP       480
     DGLEIRREYD EWGRLIQETA PDGDITRYRY DNPHSDLPCA TEDATGSRKT MTWSRYGQLL       540
     SFTDCSGYVT RYDHDRFGQV TAVHREEGLS QYRAYDSRGQ LIAVKDTQGH ETRYEYNAAG       600
     DLTTVIAPDG SRNGTQYDAW GKAICTTQGG LTRSMEYDAA GRVIRLTSEN GSHTTFRYDV       660
     LDRLIQETGF DGRTQRYHHD LTGKLIRSED EGLVTHWHYD EADRLTHRTV NGETAERWQY       720
     DERGWLTDIS HISEGHRVTV HYGYDSKGRL ASEHLTVHHP QTNELLWQHE TRHAYNAQGL       780
     ANRCIPDSLP AVEWLTYGSG WLSGMKLGDT PLVEYTRDRL HRETLRSFGR YELTTAYTPA       840
     GQLQSQHLNS LLSDRDYTWN DNGELIRISS PRQTRSYSYS TTGRLTGVHT TAANLDIRIP       900
     YTTDPAGNRL PDPELHPDSA LSMWPDNRIA RDAHYLYRYD RHGRLTEKTD LIPEGVIRTD       960
     DERTHRYHYD SQHRLVHYTR TQYAEPLVES RYLYDPLGRR VAKRVWRRER DLTGWMSLSR      1020
     KPQVTWYGWD GDRLTTIQND RTRIQTIYQP GSFTPLIRVE TATGELAKTQ RRSLADTLQQ      1080
     SGGEDGGSVV FPPVLVQMLD RLESEILADR VSEESRRWLA SCGLTVAQMQ SQMDPVYTPA      1140
     RKIHLYHCDH RGLPLALIST EGTTAWYAEY DEWGNLLNEE NPHQLQQLIR LPGQQYDEES      1200
     GLYYNRHRYY DPLQGRYITQ DPIGLKGGWN FYQYPLNPIS NIDPLGLETL KCIKPLHSMG      1260
     GTGERSGPDI WGNPFYHQYL CVPDGKGDYT CGGQDQRGES KGDGLWGPGK ASNDTKEAAG      1320
     RCDLVETDNS CVENCLKGKF KEVRPRYSVL PDIFTPINLG LFKNCQDWSN DSLETCKMKC      1380
     SGNNIGRFIR FVFTGVM                                                     1397
//

If you have problems or comments...

PBIL Back to PBIL home page