(data stored in ACNUC7421 zone)

EMBL: CP000948.RPST

CP000948.RPST        Location/Qualifiers
FT   CDS             complement(20815..21078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="ECDH10B_0024"
FT                   /product="30S ribosomal subunit protein S20"
FT                   /note="The sequence ambiguity (R) at residue 183 of this
FT                   gene may represent a mixed population, but the change is
FT                   synonymous (CAA and CAG both encode Q)"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01228"
FT                   /db_xref="GOA:B1XBE8"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XBE8"
FT                   /protein_id="ACB01228.1"
FT                   /translation="MANIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKA
FT                   AAQKAFNEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA"
     MANIKSAKKR AIQSEKARKH NASRRSMMRT FIKKVYAAIE AGDKAAAQKA FNEMQPIVDR        60
     XAAKGLIHKN KAARHKANLT AQINKLA                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page