(data stored in ACNUC7421 zone)

EMBL: CP000948.SDHB

CP000948.SDHB        Location/Qualifiers
FT   CDS             809504..810220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="ECDH10B_0791"
FT                   /product="succinate dehydrogenase, FeS subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0791"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01933"
FT                   /protein_id="ACB01933.1"
FT                   /translation="MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEK
FT                   DPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLV
FT                   VDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFW
FT                   WNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNP
FT                   TRAIGHIKSMLLQRNA"
     MRLEFSIYRY NPDVDDAPRM QDYTLEADEG RDMMLLDALI QLKEKDPSLS FRRSCREGVC        60
     GSDGLNMNGK NGLACITPIS ALNQPGKKIV IRPLPGLPVI RDLVVDMGQF YAQYEKIKPY       120
     LLNNGQNPPA REHLQMPEQR EKLDGLYECI LCACCSTSCP SFWWNPDKFI GPAGLLAAYR       180
     FLIDSRDTET DSRLDGLSDA FSVFRCHSIM NCVSVCPKGL NPTRAIGHIK SMLLQRNA         238
//

If you have problems or comments...

PBIL Back to PBIL home page