(data stored in ACNUC7421 zone)

EMBL: CP000948.SFMA

CP000948.SFMA        Location/Qualifiers
FT   CDS             496767..497309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmA"
FT                   /locus_tag="ECDH10B_0486"
FT                   /product="predicted fimbrial-like adhesin protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01655"
FT                   /protein_id="ACB01655.1"
FT                   /translation="MKLRFISSALAAALFAATGSYAAVVDGGTIHFEGELVNAACSVNT
FT                   DSADQVVTLGQYRTDIFNAVGNTSALIPFTIQLNDCDPVVAANAAVAFSGQADAINDNL
FT                   LAIASSTNTTTATGVGIEILDNTSAILKPDGNSFSTNQNLIPGTNVLHFSARYKGTGTS
FT                   ASAGQANADATFIMRYE"
     MKLRFISSAL AAALFAATGS YAAVVDGGTI HFEGELVNAA CSVNTDSADQ VVTLGQYRTD        60
     IFNAVGNTSA LIPFTIQLND CDPVVAANAA VAFSGQADAI NDNLLAIASS TNTTTATGVG       120
     IEILDNTSAI LKPDGNSFST NQNLIPGTNV LHFSARYKGT GTSASAGQAN ADATFIMRYE       180
//

If you have problems or comments...

PBIL Back to PBIL home page