(data stored in ACNUC7421 zone)

EMBL: CP000948.SFMD

CP000948.SFMD        Location/Qualifiers
FT   CDS             498252..500855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmD"
FT                   /locus_tag="ECDH10B_0488"
FT                   /product="predicted outer membrane export usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01657"
FT                   /protein_id="ACB01657.1"
FT                   /translation="MKIPTTTDIPQRYTWCLAGICYSSLAILPSFLSYAESYFNPAFLL
FT                   ENGTSVADLSRFERGNHQPAGVYRVDLWRNDEFIGSQDIVFESTTENTGDKSGGLMPCF
FT                   NQVLLERIGLNSSAFPELAQQQNNKCINLLKAVPDATINFDFAAMRLNITIPQIALLSS
FT                   AHGYIPPEEWDEGIPALLLNYNFTGNRGNGNDSYFFSELSGINIGPWRLRNNGSWNYFR
FT                   GNGYHSEQWNNIGTWVQRAIIPLKSELVMGDGNTGSDIFDGVGFRGVRLYSSDNMYPDS
FT                   QQGFAPTVRGIARTAAQLTIRQNGFIIYQSYVSPGAFEITDLHPTSSNGDLDVTIDERD
FT                   GNQQNYTIPYSTVPILQREGRFKFDLTAGDFRSGNSQQSSPFFFQGTALGGLPQEFTAY
FT                   GGTQLSANYTAFLLGLGRNLGNWGAVSLDVTHARSQLADASRHEGDSIRFLYAKSMNTF
FT                   GTNFQLMGYRYSTQGFYTLDDVAYRRMEGYEYDYDGEHRDEPIIVNYHNLRFSRKDRLQ
FT                   LNVSQSLNDFGSLYISGTHQKYWNTSDSDTWYQVGYTSSWVGISYSLSFSWNESVGIPD
FT                   NERIVGLNVSVPFNVLTKRRYTRENALDRAYASFNANRNSNGQNSWLAGVGGTLLEGHN
FT                   LSYHVSQGDTSNNGYTGSATANWQAAYGTLGGGYNYDRDQHDVNWQLSGGVVGHENGIT
FT                   LSQPLGDTNVLIKAPGAGGVRIENQTGILTDWRGYAVMLYATVYRYNRIALDTNTMGNS
FT                   IDVEKNISSVVPTQGALVRANFDTRIGVRALITVTQGGKPVPFGSLVRENSTGITSMVG
FT                   DDGQVYLSGAPLSGELLVQWGDGANSRCIAHYVLPKQSLQQAVTVISAVCTHPGS"
     MKIPTTTDIP QRYTWCLAGI CYSSLAILPS FLSYAESYFN PAFLLENGTS VADLSRFERG        60
     NHQPAGVYRV DLWRNDEFIG SQDIVFESTT ENTGDKSGGL MPCFNQVLLE RIGLNSSAFP       120
     ELAQQQNNKC INLLKAVPDA TINFDFAAMR LNITIPQIAL LSSAHGYIPP EEWDEGIPAL       180
     LLNYNFTGNR GNGNDSYFFS ELSGINIGPW RLRNNGSWNY FRGNGYHSEQ WNNIGTWVQR       240
     AIIPLKSELV MGDGNTGSDI FDGVGFRGVR LYSSDNMYPD SQQGFAPTVR GIARTAAQLT       300
     IRQNGFIIYQ SYVSPGAFEI TDLHPTSSNG DLDVTIDERD GNQQNYTIPY STVPILQREG       360
     RFKFDLTAGD FRSGNSQQSS PFFFQGTALG GLPQEFTAYG GTQLSANYTA FLLGLGRNLG       420
     NWGAVSLDVT HARSQLADAS RHEGDSIRFL YAKSMNTFGT NFQLMGYRYS TQGFYTLDDV       480
     AYRRMEGYEY DYDGEHRDEP IIVNYHNLRF SRKDRLQLNV SQSLNDFGSL YISGTHQKYW       540
     NTSDSDTWYQ VGYTSSWVGI SYSLSFSWNE SVGIPDNERI VGLNVSVPFN VLTKRRYTRE       600
     NALDRAYASF NANRNSNGQN SWLAGVGGTL LEGHNLSYHV SQGDTSNNGY TGSATANWQA       660
     AYGTLGGGYN YDRDQHDVNW QLSGGVVGHE NGITLSQPLG DTNVLIKAPG AGGVRIENQT       720
     GILTDWRGYA VMLYATVYRY NRIALDTNTM GNSIDVEKNI SSVVPTQGAL VRANFDTRIG       780
     VRALITVTQG GKPVPFGSLV RENSTGITSM VGDDGQVYLS GAPLSGELLV QWGDGANSRC       840
     IAHYVLPKQS LQQAVTVISA VCTHPGS                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page