(data stored in ACNUC7421 zone)

EMBL: CP000948.SFMF

CP000948.SFMF        Location/Qualifiers
FT   CDS             501885..502400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmF"
FT                   /locus_tag="ECDH10B_0490"
FT                   /product="predicted fimbrial-like adhesin protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01659"
FT                   /protein_id="ACB01659.1"
FT                   /translation="MRRVLFSCFCGLLWSSSGWAVDPLGTININLHGNVVDFSCTVNTA
FT                   DIDKTVDLGRWPTTQLLNAGDTTALVPFSLRLEGCPPGSVAILFTGTPASDTNLLALDD
FT                   PAMAQTVAIELRNSDRSRLALGEASPTEEVDANGNVTLNFFANYRALASGVRPGVAKAD
FT                   AIFMINYN"
     MRRVLFSCFC GLLWSSSGWA VDPLGTININ LHGNVVDFSC TVNTADIDKT VDLGRWPTTQ        60
     LLNAGDTTAL VPFSLRLEGC PPGSVAILFT GTPASDTNLL ALDDPAMAQT VAIELRNSDR       120
     SRLALGEASP TEEVDANGNV TLNFFANYRA LASGVRPGVA KADAIFMINY N                171
//

If you have problems or comments...

PBIL Back to PBIL home page