(data stored in ACNUC7421 zone)

EMBL: CP000948.SFMH

CP000948.SFMH        Location/Qualifiers
FT   CDS             500891..501874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmH"
FT                   /locus_tag="ECDH10B_0489"
FT                   /product="predicted fimbrial-like adhesin protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01658"
FT                   /protein_id="ACB01658.1"
FT                   /translation="MAMACLCLANISWATVCANSTGVAEDEHYDLSNIFNSTNNQPGQI
FT                   VVLPEKSGWVGVSAICPPGTLVNYTYRSYVTNFIVQETIDNYKYMQLHDYLLGAMSLVD
FT                   SVMDIQFPPQNYIRMGTDPNVSQNLPFGVMDSRLIFRLKVIRPFINMVEIPRQVMFTVY
FT                   VTSTPYDPLVTPVYTISFGGRVEVPQNCELNAGQIVEFDFGDIGASLFSAAGPGNRPAG
FT                   VMPQTKSIAVKCTNVAAQAYLTMRLEASAVSGQAMVSDNQDLGFIVADQNDTPITPNDL
FT                   NSVIPFRLDAAAAANVTLRAWPISITGQKPTEGPFSALGYLRVDYQ"
     MAMACLCLAN ISWATVCANS TGVAEDEHYD LSNIFNSTNN QPGQIVVLPE KSGWVGVSAI        60
     CPPGTLVNYT YRSYVTNFIV QETIDNYKYM QLHDYLLGAM SLVDSVMDIQ FPPQNYIRMG       120
     TDPNVSQNLP FGVMDSRLIF RLKVIRPFIN MVEIPRQVMF TVYVTSTPYD PLVTPVYTIS       180
     FGGRVEVPQN CELNAGQIVE FDFGDIGASL FSAAGPGNRP AGVMPQTKSI AVKCTNVAAQ       240
     AYLTMRLEAS AVSGQAMVSD NQDLGFIVAD QNDTPITPND LNSVIPFRLD AAAAANVTLR       300
     AWPISITGQK PTEGPFSALG YLRVDYQ                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page