(data stored in ACNUC7421 zone)

EMBL: CP000948.TAUA

CP000948.TAUA        Location/Qualifiers
FT   CDS             323787..324749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauA"
FT                   /locus_tag="ECDH10B_0321"
FT                   /product="taurine transporter subunit; periplasmic-binding
FT                   component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01496"
FT                   /protein_id="ACB01496.1"
FT                   /translation="MAISSRNTLLAALAFIAFQAQAVNVTVAYQTSAEPAKVAQADNTF
FT                   AKESGATVDWRKFDSGASIVRALASGDVQIGNLGSSPLAVAASQQVPIEVFLLASKLGN
FT                   SEALVVKKTISKPEDLIGKRIAVPFISTTHYSLLAALKHWGIKPGQVEIVNLQPPAIIA
FT                   AWQRGDIDGAYVWAPAVNALEKDGKVLTDSEQVGQWGAPTLDVWVVRKDFAEKHPEVVK
FT                   AFAKSAIDAQQPYIANPDVWLKQPENISKLARLSGVPEGDVPGLVKGNTYLTPQQQTAE
FT                   LTGPVNKAIIDTAQFLKEQGKVPAVANDYSQYVTSRFVQ"
     MAISSRNTLL AALAFIAFQA QAVNVTVAYQ TSAEPAKVAQ ADNTFAKESG ATVDWRKFDS        60
     GASIVRALAS GDVQIGNLGS SPLAVAASQQ VPIEVFLLAS KLGNSEALVV KKTISKPEDL       120
     IGKRIAVPFI STTHYSLLAA LKHWGIKPGQ VEIVNLQPPA IIAAWQRGDI DGAYVWAPAV       180
     NALEKDGKVL TDSEQVGQWG APTLDVWVVR KDFAEKHPEV VKAFAKSAID AQQPYIANPD       240
     VWLKQPENIS KLARLSGVPE GDVPGLVKGN TYLTPQQQTA ELTGPVNKAI IDTAQFLKEQ       300
     GKVPAVANDY SQYVTSRFVQ                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page