(data stored in ACNUC7421 zone)

EMBL: CP000948.TAUB

CP000948.TAUB        Location/Qualifiers
FT   CDS             324762..325529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauB"
FT                   /locus_tag="ECDH10B_0322"
FT                   /product="taurine transporter subunit; ATP-binding
FT                   component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01497"
FT                   /protein_id="ACB01497.1"
FT                   /translation="MLQISHLYADYGGKPALEDINLTLESGELLVVLGPSGCGKTTLLN
FT                   LIAGFVPYQHGSIQLAGKRIEGPGAERGVVFQNEGLLPWRNVQDNVAFGLQLAGIEKMQ
FT                   RLEIAHQMLKKVGLEGAEKRYIWQLSGGQRQRVGIARALAANPQLLLLDEPFGALDAFT
FT                   RDQMQTLLLKLWQETGKQVLLITHDIEEAVFMATELVLLSSGPGRVLERLPLNFARRFV
FT                   AGESSRSIKSDPQFIAMREYVLSRVFEQREAFS"
     MLQISHLYAD YGGKPALEDI NLTLESGELL VVLGPSGCGK TTLLNLIAGF VPYQHGSIQL        60
     AGKRIEGPGA ERGVVFQNEG LLPWRNVQDN VAFGLQLAGI EKMQRLEIAH QMLKKVGLEG       120
     AEKRYIWQLS GGQRQRVGIA RALAANPQLL LLDEPFGALD AFTRDQMQTL LLKLWQETGK       180
     QVLLITHDIE EAVFMATELV LLSSGPGRVL ERLPLNFARR FVAGESSRSI KSDPQFIAMR       240
     EYVLSRVFEQ REAFS                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page