(data stored in ACNUC7421 zone)

EMBL: CP000948.TAUC

CP000948.TAUC        Location/Qualifiers
FT   CDS             325526..326353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauC"
FT                   /locus_tag="ECDH10B_0323"
FT                   /product="taurine transporter subunit; membrane component
FT                   of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01498"
FT                   /protein_id="ACB01498.1"
FT                   /translation="MSVLINEKLHSRRLKWRWPLSRQVTLSIGTLAVLLTVWWTVATLQ
FT                   LISPLFLPPPQQVLEKLLTIAGPQGFMDATLWQHLAASLTRIMLALFAAVLFGIPVGIA
FT                   MGLSPTVRGILDPIIELYRPVPPLAYLPLMVIWFGIGETSKILLIYLAIFAPVAMSALA
FT                   GVKSVQQVRIRAAQSLGASRAQVLWFVILPGALPEILTGLRIGLGVGWSTLVAAELIAA
FT                   TRGLGFMVQSAGEFLATDVVLAGIAVIAIIAFLLELGLRALQRRLTPWHGEVQ"
     MSVLINEKLH SRRLKWRWPL SRQVTLSIGT LAVLLTVWWT VATLQLISPL FLPPPQQVLE        60
     KLLTIAGPQG FMDATLWQHL AASLTRIMLA LFAAVLFGIP VGIAMGLSPT VRGILDPIIE       120
     LYRPVPPLAY LPLMVIWFGI GETSKILLIY LAIFAPVAMS ALAGVKSVQQ VRIRAAQSLG       180
     ASRAQVLWFV ILPGALPEIL TGLRIGLGVG WSTLVAAELI AATRGLGFMV QSAGEFLATD       240
     VVLAGIAVIA IIAFLLELGL RALQRRLTPW HGEVQ                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page