(data stored in ACNUC7421 zone)

EMBL: CP000948.YAAA

CP000948.YAAA        Location/Qualifiers
FT   CDS             complement(5683..6459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaA"
FT                   /locus_tag="ECDH10B_0006"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01211"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XBD1"
FT                   /protein_id="ACB01211.1"
FT                   /translation="MLILISPAKTLDYQSPLTTTRYTLPELLDNSQQLIHEARKLTPPQ
FT                   ISTLMRISDKLAGINAARFHDWQPDFTPANARQAILAFKGDVYTGLQAETFSEDDFDFA
FT                   QQHLRMLSGLYGVLRPLDLMQPYRLEMGIRLENARGKDLYQFWGDIITNKLNEALAAQG
FT                   DNVVINLASDEYFKSVKPKKLNAEIIKPVFLDEKNGKFKIISFYAKKARGLMSRFIIEN
FT                   RLTKPEQLTGFNSEGYFFDEDSSSNGELVFKRYEQR"
     MLILISPAKT LDYQSPLTTT RYTLPELLDN SQQLIHEARK LTPPQISTLM RISDKLAGIN        60
     AARFHDWQPD FTPANARQAI LAFKGDVYTG LQAETFSEDD FDFAQQHLRM LSGLYGVLRP       120
     LDLMQPYRLE MGIRLENARG KDLYQFWGDI ITNKLNEALA AQGDNVVINL ASDEYFKSVK       180
     PKKLNAEIIK PVFLDEKNGK FKIISFYAKK ARGLMSRFII ENRLTKPEQL TGFNSEGYFF       240
     DEDSSSNGEL VFKRYEQR                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page