(data stored in ACNUC7421 zone)

EMBL: CP000948.YAAH

CP000948.YAAH        Location/Qualifiers
FT   CDS             complement(9928..10494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaH"
FT                   /locus_tag="ECDH10B_0010"
FT                   /product="conserved inner membrane protein associated with
FT                   acetate transport"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01215"
FT                   /protein_id="ACB01215.1"
FT                   /translation="MGNTKLANPAPLGLMGFGMTTILLNLHNVGYFALDGIILAMGIFY
FT                   GGIAQIFAGLLEYKKGNTFGLTAFTSYGSFWLTLVAILLMPKLGLTDAPNAQFLGVYLG
FT                   LWGVFTLFMFFGTLKGARVLQFVFFSLTVLFALLAIGNIAGNAAIIHFAGWIGLICGAS
FT                   AIYLAMGEVLNEQFGRTVLPIGESH"
     MGNTKLANPA PLGLMGFGMT TILLNLHNVG YFALDGIILA MGIFYGGIAQ IFAGLLEYKK        60
     GNTFGLTAFT SYGSFWLTLV AILLMPKLGL TDAPNAQFLG VYLGLWGVFT LFMFFGTLKG       120
     ARVLQFVFFS LTVLFALLAI GNIAGNAAII HFAGWIGLIC GASAIYLAMG EVLNEQFGRT       180
     VLPIGESH                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page