(data stored in ACNUC7421 zone)

EMBL: CP000948.YAAX

CP000948.YAAX        Location/Qualifiers
FT   CDS             5234..5530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaX"
FT                   /locus_tag="ECDH10B_0005"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01210"
FT                   /protein_id="ACB01210.1"
FT                   /translation="MKKMQSIVLALSLVLVAPMAAQAAEITLVPSVKLQIGDRDNRGYY
FT                   WDGGHWRDHGWWKQHYEWRGNRWHLHGPPPPPRHHKKAPHDHHGGHGPGKHHR"
     MKKMQSIVLA LSLVLVAPMA AQAAEITLVP SVKLQIGDRD NRGYYWDGGH WRDHGWWKQH        60
     YEWRGNRWHL HGPPPPPRHH KKAPHDHHGG HGPGKHHR                                98
//

If you have problems or comments...

PBIL Back to PBIL home page