(data stored in ACNUC7421 zone)

EMBL: CP000948.YACC

CP000948.YACC        Location/Qualifiers
FT   CDS             complement(110674..111021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacC"
FT                   /locus_tag="ECDH10B_0102"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01301"
FT                   /protein_id="ACB01301.1"
FT                   /translation="MKTFFRTVLFGSLMAVCANSYALSESEAEDMADLTAVFVFLKNDC
FT                   GYQNLPNGQIRRALVFFAQQNQWDLSNYDTFDMKALGEDSYRDLSGIGIPVAKKCKALA
FT                   RDSLSLLAYVK"
     MKTFFRTVLF GSLMAVCANS YALSESEAED MADLTAVFVF LKNDCGYQNL PNGQIRRALV        60
     FFAQQNQWDL SNYDTFDMKA LGEDSYRDLS GIGIPVAKKC KALARDSLSL LAYVK            115
//

If you have problems or comments...

PBIL Back to PBIL home page