(data stored in ACNUC7421 zone)

EMBL: CP000948.YACG

CP000948.YACG        Location/Qualifiers
FT   CDS             complement(85753..85950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacG"
FT                   /locus_tag="ECDH10B_0082"
FT                   /product="zinc-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01281"
FT                   /db_xref="GOA:B1XC77"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XC77"
FT                   /protein_id="ACB01281.1"
FT                   /translation="MSETITVNCPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEK
FT                   RIPSSGDLSESDDWSEEPKQ"
     MSETITVNCP TCGKTVVWGE ISPFRPFCSK RCQLIDLGEW AAEEKRIPSS GDLSESDDWS        60
     EEPKQ                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page