(data stored in ACNUC7421 zone)

EMBL: CP000948.YADC

CP000948.YADC        Location/Qualifiers
FT   CDS             complement(123819..125057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadC"
FT                   /locus_tag="ECDH10B_0115"
FT                   /product="predicted fimbrial-like adhesin protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01314"
FT                   /protein_id="ACB01314.1"
FT                   /translation="MKTIFRYILFLALYSCCNTVSAYTSFIVGNNAGVDNYRGPSTAAQ
FT                   MTFNYTSTASNLVFYKPTQLGPTGVKMYWSYLDTGTGGGILYCNTSGRANPGPITIENA
FT                   MVYSGKDYGGHKLFNTSVPGLYYTMLISRVWSAYDTITDIQSPGIYIGDPSNQEFFFSV
FT                   TDSDLQTKGCNKADDYDKFWAIGGIVHNITVEFYTDTNFDPTLNQQVQLSSSSNYLYSF
FT                   KAYSPGTKVVDHSNHIYVNFTLNNVKLTLPTCFTSILTGPSVNGSTVRMGEYSSGTIKN
FT                   GASPVPFDISLQNCIRVRNIETKLVTGKVGTQNTQLLGNTLTGSTAAKGVGVLIEGLAT
FT                   SKNPLMTLKPNDTNSVYIDYETEDDTSDGVYPNQGNGTSQPLHFQATLKQDGNIAIEPG
FT                   EFKATSTFQVTYP"
     MKTIFRYILF LALYSCCNTV SAYTSFIVGN NAGVDNYRGP STAAQMTFNY TSTASNLVFY        60
     KPTQLGPTGV KMYWSYLDTG TGGGILYCNT SGRANPGPIT IENAMVYSGK DYGGHKLFNT       120
     SVPGLYYTML ISRVWSAYDT ITDIQSPGIY IGDPSNQEFF FSVTDSDLQT KGCNKADDYD       180
     KFWAIGGIVH NITVEFYTDT NFDPTLNQQV QLSSSSNYLY SFKAYSPGTK VVDHSNHIYV       240
     NFTLNNVKLT LPTCFTSILT GPSVNGSTVR MGEYSSGTIK NGASPVPFDI SLQNCIRVRN       300
     IETKLVTGKV GTQNTQLLGN TLTGSTAAKG VGVLIEGLAT SKNPLMTLKP NDTNSVYIDY       360
     ETEDDTSDGV YPNQGNGTSQ PLHFQATLKQ DGNIAIEPGE FKATSTFQVT YP               412
//

If you have problems or comments...

PBIL Back to PBIL home page