(data stored in ACNUC7421 zone)

EMBL: CP000948.YADI

CP000948.YADI        Location/Qualifiers
FT   CDS             118681..119121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadI"
FT                   /locus_tag="ECDH10B_0109"
FT                   /product="predicted PTS Enzyme IIA"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01308"
FT                   /protein_id="ACB01308.1"
FT                   /translation="MLGWVITCHDDRAQEILDALEKKHGALLQCRAVNFWRGLSSNMLS
FT                   RMMCDALHEADSGEGVIFLTDIAGAPPYRVASLLSHKHSRCEVISGVTLPLIEQMMACR
FT                   ETMTSSEFRERIVELGAPEVSSLWHQQQKNPPFVLKHNLYEY"
     MLGWVITCHD DRAQEILDAL EKKHGALLQC RAVNFWRGLS SNMLSRMMCD ALHEADSGEG        60
     VIFLTDIAGA PPYRVASLLS HKHSRCEVIS GVTLPLIEQM MACRETMTSS EFRERIVELG       120
     APEVSSLWHQ QQKNPPFVLK HNLYEY                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page