(data stored in ACNUC7421 zone)

EMBL: CP000948.YADL

CP000948.YADL        Location/Qualifiers
FT   CDS             complement(125730..126335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadL"
FT                   /locus_tag="ECDH10B_0117"
FT                   /product="predicted fimbrial-like adhesin protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01316"
FT                   /protein_id="ACB01316.1"
FT                   /translation="MMTFKNLRYGLSSSVVLAASLFSVLSYAATDSIGLTVITTVEMGT
FT                   CTATLVNDSDQDISVVDFGDVYISEINAKTKVKTFKLKFKDCAGIPNKKAQIKLTKRAT
FT                   CEGTANDGAGFANGSTAADKASAVAVEVWSTVTPATGSATQFSCVTPASQEVTISTAAN
FT                   AVVYYPMSARLVVEKNKTVNNVTAGKFSAPATFTVTYN"
     MMTFKNLRYG LSSSVVLAAS LFSVLSYAAT DSIGLTVITT VEMGTCTATL VNDSDQDISV        60
     VDFGDVYISE INAKTKVKTF KLKFKDCAGI PNKKAQIKLT KRATCEGTAN DGAGFANGST       120
     AADKASAVAV EVWSTVTPAT GSATQFSCVT PASQEVTIST AANAVVYYPM SARLVVEKNK       180
     TVNNVTAGKF SAPATFTVTY N                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page