(data stored in ACNUC7421 zone)

EMBL: CP000948.YADM

CP000948.YADM        Location/Qualifiers
FT   CDS             complement(126347..126916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadM"
FT                   /locus_tag="ECDH10B_0118"
FT                   /product="predicted fimbrial-like adhesin protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01317"
FT                   /protein_id="ACB01317.1"
FT                   /translation="MIKTTPHKIVILMGILLSPSVFATDINVEFTATVKATTCNITLTG
FT                   NNVTNDGNNNYTLRIPKMGLDKIANKTTESQADFKLVASGCSSGISWIDTTLTGNASSS
FT                   SPKLIIPQSGDSSSTTSNIGMGFKKRTTDDATFLKPNSAEKIRWSTDEMQPDKGLEMTV
FT                   ALRETDAGQGVPGNFRALATFNFIYQ"
     MIKTTPHKIV ILMGILLSPS VFATDINVEF TATVKATTCN ITLTGNNVTN DGNNNYTLRI        60
     PKMGLDKIAN KTTESQADFK LVASGCSSGI SWIDTTLTGN ASSSSPKLII PQSGDSSSTT       120
     SNIGMGFKKR TTDDATFLKP NSAEKIRWST DEMQPDKGLE MTVALRETDA GQGVPGNFRA       180
     LATFNFIYQ                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page