(data stored in ACNUC7421 zone)

EMBL: CP000948.YADS

CP000948.YADS        Location/Qualifiers
FT   CDS             complement(151105..151728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadS"
FT                   /locus_tag="ECDH10B_0137"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01336"
FT                   /protein_id="ACB01336.1"
FT                   /translation="MLVYWLDIVGTAVFAISGVLLAGKLRMDPFGVLVLGVVTAVGGGT
FT                   IRDMALDHGPVFWVKDPTDLVVAMVTSMLTIVLVRQPRRLPKWMLPVLDAVGLAVFVGI
FT                   GVNKAFNAEAGPLIAVCMGVITGVGGGIIRDVLAREIPMILRTEIYATACIIGGIVHAT
FT                   AYYTFSVPLETASMMGMVVTLLIRLAAIRWHLKLPTFALDENGR"
     MLVYWLDIVG TAVFAISGVL LAGKLRMDPF GVLVLGVVTA VGGGTIRDMA LDHGPVFWVK        60
     DPTDLVVAMV TSMLTIVLVR QPRRLPKWML PVLDAVGLAV FVGIGVNKAF NAEAGPLIAV       120
     CMGVITGVGG GIIRDVLARE IPMILRTEIY ATACIIGGIV HATAYYTFSV PLETASMMGM       180
     VVTLLIRLAA IRWHLKLPTF ALDENGR                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page