(data stored in ACNUC7421 zone)

EMBL: CP000948.YAEB

CP000948.YAEB        Location/Qualifiers
FT   CDS             complement(192991..193698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeB"
FT                   /locus_tag="ECDH10B_0176"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01374"
FT                   /protein_id="ACB01374.1"
FT                   /translation="MSSFQFEQIGVIRSPYKEKFAVPRQPGLVKSANGELHLIAPYNQA
FT                   DAVRGLEAFSHLWILFVFHQTMEGGWRPTVRPPRLGGNARMGVFATRSTFRPNPIGMSL
FT                   VELKEVVCHKDSVILKLGSLDLVDGTPVVDIKPYLPFAESLPDASASYAQSAPAAEMAV
FT                   SFTAEVEKQLLTLEKRYPQLTLFIREVLAQDPRPAYRKGEETGKTYAVWLHDFNVRWRV
FT                   TDAGFEVFALEPR"
     MSSFQFEQIG VIRSPYKEKF AVPRQPGLVK SANGELHLIA PYNQADAVRG LEAFSHLWIL        60
     FVFHQTMEGG WRPTVRPPRL GGNARMGVFA TRSTFRPNPI GMSLVELKEV VCHKDSVILK       120
     LGSLDLVDGT PVVDIKPYLP FAESLPDASA SYAQSAPAAE MAVSFTAEVE KQLLTLEKRY       180
     PQLTLFIREV LAQDPRPAYR KGEETGKTYA VWLHDFNVRW RVTDAGFEVF ALEPR            235
//

If you have problems or comments...

PBIL Back to PBIL home page