(data stored in ACNUC7421 zone)

EMBL: CP000948.YAEJ

CP000948.YAEJ        Location/Qualifiers
FT   CDS             188937..189359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeJ"
FT                   /locus_tag="ECDH10B_0172"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01370"
FT                   /protein_id="ACB01370.1"
FT                   /translation="MIVISRHVAIPDGELEITAIRAQGAGGQHVNKTSTAIHLRFDIRA
FT                   SSLPEYYKERLLAASHHLISSDGVIVIKAQEYRSQELNREAALARLVAMIKELTTEKKA
FT                   RRPTRPTRASKERRLASKAQKSSVKAMRGKVRSGRE"
     MIVISRHVAI PDGELEITAI RAQGAGGQHV NKTSTAIHLR FDIRASSLPE YYKERLLAAS        60
     HHLISSDGVI VIKAQEYRSQ ELNREAALAR LVAMIKELTT EKKARRPTRP TRASKERRLA       120
     SKAQKSSVKA MRGKVRSGRE                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page