(data stored in ACNUC7421 zone)

EMBL: CP000948.YAFD

CP000948.YAFD        Location/Qualifiers
FT   CDS             205226..206026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafD"
FT                   /locus_tag="ECDH10B_0190"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01382"
FT                   /db_xref="GOA:B1XD73"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR022958"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XD73"
FT                   /protein_id="ACB01382.1"
FT                   /translation="MRKNTYAMRYVAGQPAERILPPGSFASIGQALPPGEPLSTEERIR
FT                   ILVWNIYKQQRAEWLSVLKNYGKDAHLVLLQEAQTTPELVQFATANYLAADQVPAFVLP
FT                   QHPSGVMTLSAAHPVYCCPLREREPILRLAKSALVTVYPLPDTRLLMVVNIHAVNFSLG
FT                   VDVYSKQLLPIGDQIAHHSGPVIMAGDFNAWSRRRMNALYRFAREMSLRQVRFTDDQRR
FT                   RAFGRPLDFVFYRGLNVSEASVLVTRASDHNPLLVEFSPGKPDK"
     MRKNTYAMRY VAGQPAERIL PPGSFASIGQ ALPPGEPLST EERIRILVWN IYKQQRAEWL        60
     SVLKNYGKDA HLVLLQEAQT TPELVQFATA NYLAADQVPA FVLPQHPSGV MTLSAAHPVY       120
     CCPLREREPI LRLAKSALVT VYPLPDTRLL MVVNIHAVNF SLGVDVYSKQ LLPIGDQIAH       180
     HSGPVIMAGD FNAWSRRRMN ALYRFAREMS LRQVRFTDDQ RRRAFGRPLD FVFYRGLNVS       240
     EASVLVTRAS DHNPLLVEFS PGKPDK                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page