(data stored in ACNUC7421 zone)

EMBL: CP000948.YAFM

CP000948.YAFM        Location/Qualifiers
FT   CDS             221741..222238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafM"
FT                   /locus_tag="ECDH10B_0210"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01399"
FT                   /protein_id="ACB01399.1"
FT                   /translation="MSEYRRYYIKGGTWFFTVNLRNRRSQLLTTQYQMLRHAIIKVKRD
FT                   RPFEINAWVVLPEHMHCIWTLPEGDDDFSSRWREIKKQFTHACGLKNIWQPRFWEHAIR
FT                   NTKDYRHHVDYIYINPVKHGWVKQVSDWPFSTFHRDVARGLYPIDWAGDVTDFSAGERI
FT                   IS"
     MSEYRRYYIK GGTWFFTVNL RNRRSQLLTT QYQMLRHAII KVKRDRPFEI NAWVVLPEHM        60
     HCIWTLPEGD DDFSSRWREI KKQFTHACGL KNIWQPRFWE HAIRNTKDYR HHVDYIYINP       120
     VKHGWVKQVS DWPFSTFHRD VARGLYPIDW AGDVTDFSAG ERIIS                       165
//

If you have problems or comments...

PBIL Back to PBIL home page