(data stored in ACNUC7421 zone)

EMBL: CP000948.YAFP

CP000948.YAFP        Location/Qualifiers
FT   CDS             226813..227265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafP"
FT                   /locus_tag="ECDH10B_0216"
FT                   /product="predicted acyltransferase with acyl-CoA
FT                   N-acyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01403"
FT                   /protein_id="ACB01403.1"
FT                   /translation="MNNIQIRNYQPGDFQQLCAIFIRAVTMTASQHYSPQQISAWAQID
FT                   ESRWKEKLAKSQVWVAIINAQPVGFISRIEHYIDMLFVDPEYTRRGVASALLKPLIKSE
FT                   SELTVDASITAKPFFERYGFQTVKQQRVECRGAWFTNFYMRYKPQH"
     MNNIQIRNYQ PGDFQQLCAI FIRAVTMTAS QHYSPQQISA WAQIDESRWK EKLAKSQVWV        60
     AIINAQPVGF ISRIEHYIDM LFVDPEYTRR GVASALLKPL IKSESELTVD ASITAKPFFE       120
     RYGFQTVKQQ RVECRGAWFT NFYMRYKPQH                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page