(data stored in ACNUC7421 zone)

EMBL: CP000948.YAFX

CP000948.YAFX        Location/Qualifiers
FT   CDS             complement(238076..238534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafX"
FT                   /locus_tag="ECDH10B_0231"
FT                   /product="CP4-6 prophage; predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01415"
FT                   /protein_id="ACB01415.1"
FT                   /translation="MTTQTQHDLAPANQPEFELTVTPVPDEQRIDFWPQYFGAIPQWLL
FT                   LEPHIFAWMDRFCEGYSGGIWSFYTLSNGGAFMSPEPDNDETWRLFNCLNGNDAQMSAE
FT                   AAGIAVCLIAYSHHACRTECDAMTAHYYRLREYAMQHPEAHAILRIID"
     MTTQTQHDLA PANQPEFELT VTPVPDEQRI DFWPQYFGAI PQWLLLEPHI FAWMDRFCEG        60
     YSGGIWSFYT LSNGGAFMSP EPDNDETWRL FNCLNGNDAQ MSAEAAGIAV CLIAYSHHAC       120
     RTECDAMTAH YYRLREYAMQ HPEAHAILRI ID                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page