(data stored in ACNUC7421 zone)

EMBL: CP000948.YAFZ

CP000948.YAFZ        Location/Qualifiers
FT   CDS             complement(240512..241333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafZ"
FT                   /locus_tag="ECDH10B_0237"
FT                   /product="CP4-6 prophage; conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01419"
FT                   /protein_id="ACB01419.1"
FT                   /translation="MTRLASRFGAANLIRRDRPLTREELFRVVPSVFSEDKHESRSERY
FT                   TYIPTISLLDSLQREGFQPFFACQTRVRDPGRREHTKHMLRLRREGQITGKQVPEIILL
FT                   NSHDGTSSYQMLPGLFRAVCQNGLVCGESFGEVRVPHKGDVVSQVIEGAYEVLGIFDRV
FT                   EEKRDAMQSLLLPPPAQQALAKAALTYRFGEDHQPVTESQILSPRRWQDESNDLWTTYQ
FT                   RIQENLIKGGLSGRNAKGGRSHTRAVRGIDGDVKLNRALWVMAEALLTQLQ"
     MTRLASRFGA ANLIRRDRPL TREELFRVVP SVFSEDKHES RSERYTYIPT ISLLDSLQRE        60
     GFQPFFACQT RVRDPGRREH TKHMLRLRRE GQITGKQVPE IILLNSHDGT SSYQMLPGLF       120
     RAVCQNGLVC GESFGEVRVP HKGDVVSQVI EGAYEVLGIF DRVEEKRDAM QSLLLPPPAQ       180
     QALAKAALTY RFGEDHQPVT ESQILSPRRW QDESNDLWTT YQRIQENLIK GGLSGRNAKG       240
     GRSHTRAVRG IDGDVKLNRA LWVMAEALLT QLQ                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page