(data stored in ACNUC7421 zone)

EMBL: CP000948.YAGJ

CP000948.YAGJ        Location/Qualifiers
FT   CDS             266274..267005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagJ"
FT                   /locus_tag="ECDH10B_0264"
FT                   /product="CP4-6 prophage; predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01442"
FT                   /protein_id="ACB01442.1"
FT                   /translation="MEARVTVAGMGLVMEVQDYFDGEADRLAKAWLAEYTPQIKSLKDE
FT                   RKEAYRQIVEMSTEPQDVDLVRPANKFEMTRVREGEKEADLPVWKHHLLCDESGNYPAL
FT                   LNHWETKVFEIETKREGFAFWYRNPQYTGQSSLGIAYVEAEQYKIVRPDFLFFAEQDGK
FT                   MVVDLVDPHSLHLADALPKLEGLALYAEHHSDAYRRIESVAEVKGKLRVLDLKRQDVQD
FT                   AVATAENAETLFSSGLADDYQ"
     MEARVTVAGM GLVMEVQDYF DGEADRLAKA WLAEYTPQIK SLKDERKEAY RQIVEMSTEP        60
     QDVDLVRPAN KFEMTRVREG EKEADLPVWK HHLLCDESGN YPALLNHWET KVFEIETKRE       120
     GFAFWYRNPQ YTGQSSLGIA YVEAEQYKIV RPDFLFFAEQ DGKMVVDLVD PHSLHLADAL       180
     PKLEGLALYA EHHSDAYRRI ESVAEVKGKL RVLDLKRQDV QDAVATAENA ETLFSSGLAD       240
     DYQ                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page