(data stored in ACNUC7421 zone)

EMBL: CP000948.YAGK

CP000948.YAGK        Location/Qualifiers
FT   CDS             complement(267096..267722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagK"
FT                   /locus_tag="ECDH10B_0265"
FT                   /product="CP4-6 prophage; conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01443"
FT                   /protein_id="ACB01443.1"
FT                   /translation="MKTYQGTHGVHILEYQSKINKLLCYLTNRYPRLIAVRVDLHYPKI
FT                   VDNGDNICCFPNLEPGVISRMRESLRAKLEADRTRKVREDKRIYRCPLFIIWAKEYSES
FT                   GKCHYHICLLFNKDAYYHLGDYDQDDNLRGMITGAWYSALRLERDDHPGLVHFPENCKY
FT                   VLDTNSTDFQQNYQALLTRLDYLTKVESKVFGEGDRNFGCSQIEL"
     MKTYQGTHGV HILEYQSKIN KLLCYLTNRY PRLIAVRVDL HYPKIVDNGD NICCFPNLEP        60
     GVISRMRESL RAKLEADRTR KVREDKRIYR CPLFIIWAKE YSESGKCHYH ICLLFNKDAY       120
     YHLGDYDQDD NLRGMITGAW YSALRLERDD HPGLVHFPEN CKYVLDTNST DFQQNYQALL       180
     TRLDYLTKVE SKVFGEGDRN FGCSQIEL                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page