(data stored in ACNUC7421 zone)

EMBL: CP000948.YAGL

CP000948.YAGL        Location/Qualifiers
FT   CDS             complement(267994..268692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagL"
FT                   /locus_tag="ECDH10B_0266"
FT                   /product="CP4-6 prophage; DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01444"
FT                   /protein_id="ACB01444.1"
FT                   /translation="MRGKILLYQLKYRWQSLSIFGCFLCKMTLFRYQKIIYDTGVHQMR
FT                   SFFYTICSSEQQESITDHHSLAEICQKFNILPEHVVIEQVDIKEVVSEQRLLRQLIHHE
FT                   MNRQDTLVIPDLSCLGRTVEDLQNILFFCLQKEMFIYSYHPASRIEPSAESCLSFLIAR
FT                   QDTIDIHNLKSTKSRYRHVKKKLGRKEGSKYRRDITILKKGGFTQAEIAKKLSISLSTV
FT                   KRHWNNGIIG"
     MRGKILLYQL KYRWQSLSIF GCFLCKMTLF RYQKIIYDTG VHQMRSFFYT ICSSEQQESI        60
     TDHHSLAEIC QKFNILPEHV VIEQVDIKEV VSEQRLLRQL IHHEMNRQDT LVIPDLSCLG       120
     RTVEDLQNIL FFCLQKEMFI YSYHPASRIE PSAESCLSFL IARQDTIDIH NLKSTKSRYR       180
     HVKKKLGRKE GSKYRRDITI LKKGGFTQAE IAKKLSISLS TVKRHWNNGI IG               232
//

If you have problems or comments...

PBIL Back to PBIL home page