(data stored in ACNUC7421 zone)

EMBL: CP000948.YAGM

CP000948.YAGM        Location/Qualifiers
FT   CDS             complement(268719..269573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagM"
FT                   /locus_tag="ECDH10B_0267"
FT                   /product="CP4-6 prophage; predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01445"
FT                   /protein_id="ACB01445.1"
FT                   /translation="MSNSVTNFEMSSVLPGKKPCQGKNNESQVVQTTPIKKHSVTFKNQ
FT                   SSLGVIDHYARLTNKSHSSVIAEVVDLAIPILEKCNRHNWSINEIKNDLLKFSIKESIN
FT                   RSRGKTEVTLEEYCSLIWKTNIMSPLKIPIADYFQLNANDEFMGKDEKTVIRERLSSLR
FT                   ENYDMEKAIYIYNQRHFDVKHQSVSGYSNIILIHRTTFEGYYFDAGQALLLSTSQLIIF
FT                   GINEVLRRKGIVMPYPVVCWIDIYHVNEMVVMLPVLRKTDVSNRVNVPDDIIINPYSQE
FT                   SRT"
     MSNSVTNFEM SSVLPGKKPC QGKNNESQVV QTTPIKKHSV TFKNQSSLGV IDHYARLTNK        60
     SHSSVIAEVV DLAIPILEKC NRHNWSINEI KNDLLKFSIK ESINRSRGKT EVTLEEYCSL       120
     IWKTNIMSPL KIPIADYFQL NANDEFMGKD EKTVIRERLS SLRENYDMEK AIYIYNQRHF       180
     DVKHQSVSGY SNIILIHRTT FEGYYFDAGQ ALLLSTSQLI IFGINEVLRR KGIVMPYPVV       240
     CWIDIYHVNE MVVMLPVLRK TDVSNRVNVP DDIIINPYSQ ESRT                        284
//

If you have problems or comments...

PBIL Back to PBIL home page