(data stored in ACNUC7421 zone)

EMBL: CP000948.YAGN

CP000948.YAGN        Location/Qualifiers
FT   CDS             complement(269913..270353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagN"
FT                   /locus_tag="ECDH10B_0268"
FT                   /product="CP4-6 prophage; predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01446"
FT                   /protein_id="ACB01446.1"
FT                   /translation="MATPATVSIEPTLAAIRARWCINSSKTTQSFNDPASMEEVVEYLK
FT                   GTYSALRKSVACAKLKILHLKQRMQNATNFLARLMSCKNQASRSHHSTAKSAKSALSSD
FT                   SGDGSDPDPEPETFPSAFITTPTNSIMLKAFFANISITEVAK"
     MATPATVSIE PTLAAIRARW CINSSKTTQS FNDPASMEEV VEYLKGTYSA LRKSVACAKL        60
     KILHLKQRMQ NATNFLARLM SCKNQASRSH HSTAKSAKSA LSSDSGDGSD PDPEPETFPS       120
     AFITTPTNSI MLKAFFANIS ITEVAK                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page