(data stored in ACNUC7421 zone)

EMBL: CP000948.YAGQ

CP000948.YAGQ        Location/Qualifiers
FT   CDS             complement(272544..273500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagQ"
FT                   /locus_tag="ECDH10B_0271"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01449"
FT                   /protein_id="ACB01449.1"
FT                   /translation="MSYPLFDKDEHWHKPEQAFLTDDHRTILRFAVEALMSGKGAVLVT
FT                   LVEIRGGAARPLGAQMVVREDGRYCGFVSGGCVEAAAAFEALEMMGSGRDREIRYGEGS
FT                   PWFDIVLPCGGGITLTLHKLRSAQPLLAVLNRLEQRKPVGLRYDPQAQSLVCLPTQTRT
FT                   GWNLNGFEVGFRPCVRLMIYGRSLEAQATASLAAATGYDSHIFDLFPASASAQIDTDTA
FT                   VILLCHDLNRELPVLQAAREAKPFYLGALGSYRTHTLRLQKLHELGWSREETTQIRAPV
FT                   GIFPKARDAHTLALSVLAEVASVRLHQEEDSCLPPSS"
     MSYPLFDKDE HWHKPEQAFL TDDHRTILRF AVEALMSGKG AVLVTLVEIR GGAARPLGAQ        60
     MVVREDGRYC GFVSGGCVEA AAAFEALEMM GSGRDREIRY GEGSPWFDIV LPCGGGITLT       120
     LHKLRSAQPL LAVLNRLEQR KPVGLRYDPQ AQSLVCLPTQ TRTGWNLNGF EVGFRPCVRL       180
     MIYGRSLEAQ ATASLAAATG YDSHIFDLFP ASASAQIDTD TAVILLCHDL NRELPVLQAA       240
     REAKPFYLGA LGSYRTHTLR LQKLHELGWS REETTQIRAP VGIFPKARDA HTLALSVLAE       300
     VASVRLHQEE DSCLPPSS                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page