(data stored in ACNUC7421 zone)

EMBL: CP000948.YAGR

CP000948.YAGR        Location/Qualifiers
FT   CDS             complement(273510..275708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagR"
FT                   /locus_tag="ECDH10B_0272"
FT                   /product="predicted oxidoreductase with molybdenum-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01450"
FT                   /protein_id="ACB01450.1"
FT                   /translation="MKFDKPAGENPIDQLKVVGRPHDRIDGPLKTTGTARYAYEWHEEA
FT                   PNAAYGYIVGSAIAKGRLTALDTDAAQKAPGVLAVITASNAGALGKGDKNTARLLGGPT
FT                   IEHYHQAIALVVAETFEQARAAASLVQAHYRRNKGAYSLADEKQAVNQPPEDTPDKNVG
FT                   DFDGAFTSAAVKIDATYTTPDQSHMAMEPHASMAVWDGNKLTLWTSNQMIDWCRTDLAK
FT                   TLKVPVENVRIISPYIGGGFGGKLFLRSDALLAALAARAVKRPVKVMLPRPSIPNNTTH
FT                   RPATLQHLRIGADQSGKITAISHESWSGNLPGGTPETAVQQSELLYAGANRHTGLRLAT
FT                   LDLPEGNAMRAPGEAPGLMALEIAIDELAEKAGIDPVEFRILNDTQVDPADPTRCFSRR
FT                   QLIECLRTGADKFGWKQRNATPGQVRDGEWLVGHGVAAGFRNNLLEKSGARVHLEQNGT
FT                   VTVETDMTDIGTGSYTILAQTAAEMLGVPLEQVAVHLGDSSFPVSAGSGGQWGANTSTS
FT                   GVYAACMKLREMIASAVGFDPEQSQFADGKITNGTRSATLHEATAGGRLTAEESIEFGT
FT                   LSKEYQQSTFAGHFVEVGVHSATGEVRVRRMLAVCAAGRILNPKTARSQVIGAMTMGMG
FT                   AALMEELAVDDRLGYFVNHDMAGYEVPVHADIPKQEVIFLDDTDPISSPMKAKGVGELG
FT                   LCGVSAAIANAVYNATGIRVRDYPITLDKLLDKLPDVV"
     MKFDKPAGEN PIDQLKVVGR PHDRIDGPLK TTGTARYAYE WHEEAPNAAY GYIVGSAIAK        60
     GRLTALDTDA AQKAPGVLAV ITASNAGALG KGDKNTARLL GGPTIEHYHQ AIALVVAETF       120
     EQARAAASLV QAHYRRNKGA YSLADEKQAV NQPPEDTPDK NVGDFDGAFT SAAVKIDATY       180
     TTPDQSHMAM EPHASMAVWD GNKLTLWTSN QMIDWCRTDL AKTLKVPVEN VRIISPYIGG       240
     GFGGKLFLRS DALLAALAAR AVKRPVKVML PRPSIPNNTT HRPATLQHLR IGADQSGKIT       300
     AISHESWSGN LPGGTPETAV QQSELLYAGA NRHTGLRLAT LDLPEGNAMR APGEAPGLMA       360
     LEIAIDELAE KAGIDPVEFR ILNDTQVDPA DPTRCFSRRQ LIECLRTGAD KFGWKQRNAT       420
     PGQVRDGEWL VGHGVAAGFR NNLLEKSGAR VHLEQNGTVT VETDMTDIGT GSYTILAQTA       480
     AEMLGVPLEQ VAVHLGDSSF PVSAGSGGQW GANTSTSGVY AACMKLREMI ASAVGFDPEQ       540
     SQFADGKITN GTRSATLHEA TAGGRLTAEE SIEFGTLSKE YQQSTFAGHF VEVGVHSATG       600
     EVRVRRMLAV CAAGRILNPK TARSQVIGAM TMGMGAALME ELAVDDRLGY FVNHDMAGYE       660
     VPVHADIPKQ EVIFLDDTDP ISSPMKAKGV GELGLCGVSA AIANAVYNAT GIRVRDYPIT       720
     LDKLLDKLPD VV                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page