(data stored in ACNUC7421 zone)

EMBL: CP000948.YAGS

CP000948.YAGS        Location/Qualifiers
FT   CDS             complement(275705..276661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagS"
FT                   /locus_tag="ECDH10B_0273"
FT                   /product="predicted oxidoreductase with FAD-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01451"
FT                   /protein_id="ACB01451.1"
FT                   /translation="MKAFTYERVNTPAEAALSAQRVPGAKFIAGGTNLLDLMKLEIETP
FT                   THLIDVNGLGLDKIEVTDAGGLRIGALVRNTDLAAHERVRRDYAVLSRALLAGASGQLR
FT                   NQATTAGNLLQRTRCPYFYDTNQPCNKRLPGSGCAALEGFSRQHAVVGVSEACIATHPS
FT                   DMAVAMRLLDAVVETITPEGKTRSITLADFYHPPGKTPHIETALLPGELIVAVTLPPPL
FT                   GGKHIYRKVRDRASYAFALVSVAAIIQPDGSGRVALGGVAHKPWRIEAADAQLSQGAQA
FT                   VYDTLFASAHPTAENTFKLLLAKRTLASVLAEARAQA"
     MKAFTYERVN TPAEAALSAQ RVPGAKFIAG GTNLLDLMKL EIETPTHLID VNGLGLDKIE        60
     VTDAGGLRIG ALVRNTDLAA HERVRRDYAV LSRALLAGAS GQLRNQATTA GNLLQRTRCP       120
     YFYDTNQPCN KRLPGSGCAA LEGFSRQHAV VGVSEACIAT HPSDMAVAMR LLDAVVETIT       180
     PEGKTRSITL ADFYHPPGKT PHIETALLPG ELIVAVTLPP PLGGKHIYRK VRDRASYAFA       240
     LVSVAAIIQP DGSGRVALGG VAHKPWRIEA ADAQLSQGAQ AVYDTLFASA HPTAENTFKL       300
     LLAKRTLASV LAEARAQA                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page