(data stored in ACNUC7421 zone)

EMBL: CP000948.YAGT

CP000948.YAGT        Location/Qualifiers
FT   CDS             complement(276658..277347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagT"
FT                   /locus_tag="ECDH10B_0274"
FT                   /product="predicted xanthine dehydrogenase, 2Fe-2S subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01452"
FT                   /protein_id="ACB01452.1"
FT                   /translation="MSNQGEYPEDNRVGKHEPHDLSLTRRDLIKVSAATAATAVVYPHS
FT                   TLAASVPAATPAPEIMPLTLKVNGKTEQLEVDTRTTLLDTLRENLHLIGTKKGCDHGQC
FT                   GACTVLVNGRRLNACLTLAVMHQGAEITTIEGLGSPDNLHPMQAAFIKHDGFQCGYCTS
FT                   GQICSSVAVLKEIQDGIPSHVTVDLVSAPETTADEIRERMSGNICRCGAYANILAAIED
FT                   AAGEIKS"
     MSNQGEYPED NRVGKHEPHD LSLTRRDLIK VSAATAATAV VYPHSTLAAS VPAATPAPEI        60
     MPLTLKVNGK TEQLEVDTRT TLLDTLRENL HLIGTKKGCD HGQCGACTVL VNGRRLNACL       120
     TLAVMHQGAE ITTIEGLGSP DNLHPMQAAF IKHDGFQCGY CTSGQICSSV AVLKEIQDGI       180
     PSHVTVDLVS APETTADEIR ERMSGNICRC GAYANILAAI EDAAGEIKS                   229
//

If you have problems or comments...

PBIL Back to PBIL home page