(data stored in ACNUC7421 zone)

EMBL: CP000948.YAGU

CP000948.YAGU        Location/Qualifiers
FT   CDS             277765..278379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagU"
FT                   /locus_tag="ECDH10B_0275"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01453"
FT                   /protein_id="ACB01453.1"
FT                   /translation="MNIFEQTPPNRRRYGLAAFIGLIAGVVSAFVKWGAEVPLPPRSPV
FT                   DMFNAACGPESLIRAAGQIDCSRNFLNPPYIFLRDWLGLTDPNAAVYTFAGHVFNWVGV
FT                   THIIFSIVFAVGYCVVAEVFPKIKLWQGLLAGALAQLFVHMISFPLMGLTPPLFDLPWY
FT                   ENVSEIFGHLVWFWSIEIIRRDLRNRITHEPDPEIPLGSNR"
     MNIFEQTPPN RRRYGLAAFI GLIAGVVSAF VKWGAEVPLP PRSPVDMFNA ACGPESLIRA        60
     AGQIDCSRNF LNPPYIFLRD WLGLTDPNAA VYTFAGHVFN WVGVTHIIFS IVFAVGYCVV       120
     AEVFPKIKLW QGLLAGALAQ LFVHMISFPL MGLTPPLFDL PWYENVSEIF GHLVWFWSIE       180
     IIRRDLRNRI THEPDPEIPL GSNR                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page