(data stored in ACNUC7421 zone)

EMBL: CP000948.YAGW

CP000948.YAGW        Location/Qualifiers
FT   CDS             complement(279948..281591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagW"
FT                   /locus_tag="ECDH10B_0278"
FT                   /product="predicted receptor"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01456"
FT                   /protein_id="ACB01456.1"
FT                   /translation="MRVNLLITMIIFALIWPVTALRAAVSKTTWADAPAREFVFVENNS
FT                   DDNFFVTPGGALDPRLTGANRWTGLKYTGSGTIYQQSLGYIDNGYNTGLYTNWKFDMWL
FT                   ENSPVSSPLTGLRCINWYAGCNMTTSLILPQTTDASGFYGATVTSGGAKWMHGMLSDAF
FT                   YQYMQQMPVGSSFTMTINACQTSVNYDASSGARCKDQASGNWYVRNVTHTKAANLRLIN
FT                   THSLAEVFINSDGVPTLGEGNADCRTQTIGSRSGLSCKMVNYTLQTNGLSNTSIHIFPA
FT                   IANSSLASAVGAYDMQFSLNGSSWKPVSNTAYYYTFNEMKSADSIYVFFSSNFFKQMVN
FT                   LGISDINTKDLFNFRFQNTTSPESGWYEFSTSNTLIIKPRDFSISIISDEYTQTPSREG
FT                   YVGSGESALDFGYIVTTSGKTAADEVLIKVTGPAQVIGGRSYCVFSSDDGKAKVPFPAT
FT                   LSFITRNGATKTYDAGCDDSWRDMTDALWLTTPWTDISGEVGQMDKTTVKFSIPMDNAI
FT                   SLRTVDDNGWFGEVSASGEIHVQATWRNIN"
     MRVNLLITMI IFALIWPVTA LRAAVSKTTW ADAPAREFVF VENNSDDNFF VTPGGALDPR        60
     LTGANRWTGL KYTGSGTIYQ QSLGYIDNGY NTGLYTNWKF DMWLENSPVS SPLTGLRCIN       120
     WYAGCNMTTS LILPQTTDAS GFYGATVTSG GAKWMHGMLS DAFYQYMQQM PVGSSFTMTI       180
     NACQTSVNYD ASSGARCKDQ ASGNWYVRNV THTKAANLRL INTHSLAEVF INSDGVPTLG       240
     EGNADCRTQT IGSRSGLSCK MVNYTLQTNG LSNTSIHIFP AIANSSLASA VGAYDMQFSL       300
     NGSSWKPVSN TAYYYTFNEM KSADSIYVFF SSNFFKQMVN LGISDINTKD LFNFRFQNTT       360
     SPESGWYEFS TSNTLIIKPR DFSISIISDE YTQTPSREGY VGSGESALDF GYIVTTSGKT       420
     AADEVLIKVT GPAQVIGGRS YCVFSSDDGK AKVPFPATLS FITRNGATKT YDAGCDDSWR       480
     DMTDALWLTT PWTDISGEVG QMDKTTVKFS IPMDNAISLR TVDDNGWFGE VSASGEIHVQ       540
     ATWRNIN                                                                 547
//

If you have problems or comments...

PBIL Back to PBIL home page