(data stored in ACNUC7421 zone)

EMBL: CP000948.YAHC

CP000948.YAHC        Location/Qualifiers
FT   CDS             complement(309299..309796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahC"
FT                   /locus_tag="ECDH10B_0304"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01482"
FT                   /protein_id="ACB01482.1"
FT                   /translation="MNGLTATGVTVGICAGLWQLVSSHVGLSQGWELLGTIGFVAFCSF
FT                   YAAGGGKSGFIRSLAVNYSGMVWAFFAALTAGWLASVSGLSAFWASVITTVPFSAVVVW
FT                   QGRFWLLSFIPGGFLGMTLFFASGMNWTVTLLGFLAGNCVGVISEYGGQKLSEATTKRD
FT                   GY"
     MNGLTATGVT VGICAGLWQL VSSHVGLSQG WELLGTIGFV AFCSFYAAGG GKSGFIRSLA        60
     VNYSGMVWAF FAALTAGWLA SVSGLSAFWA SVITTVPFSA VVVWQGRFWL LSFIPGGFLG       120
     MTLFFASGMN WTVTLLGFLA GNCVGVISEY GGQKLSEATT KRDGY                       165
//

If you have problems or comments...

PBIL Back to PBIL home page