(data stored in ACNUC7421 zone)

EMBL: CP000948.YAHF

CP000948.YAHF        Location/Qualifiers
FT   CDS             311552..313099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahF"
FT                   /locus_tag="ECDH10B_0307"
FT                   /product="predicted acyl-CoA synthetase with NAD(P)-binding
FT                   domain and succinyl-CoA synthetase domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01485"
FT                   /protein_id="ACB01485.1"
FT                   /translation="MSVKIVIKPNTYFDSVSLMSISTRANKLDGVEQAFVAMATEMNKG
FT                   VLKNLGLLTPELEQAKNGDLMIVINGKSGADNEQLLVEIEELFNTKAQSGSHEARYATI
FT                   GSAKKHIPESNLAVISVNGLFAAREARQALQNDLNVMLFSDNVSVEDELALKQLAHEKG
FT                   LLMMGPDCGTAIINGAALCFGNAVRRGNIGIVGASGTGSQELSVRIHEFGGGVSQLIGT
FT                   GGRDLSEKIGGLMMLDAIGMLENDPQTEIIALISKPPAPAVARKVLERARACRKPVVVC
FT                   FLDRGETPVDEQGLQFARGTKEAALKAVMLSGVKQENLDLHTLNQPLIADVRARLQPQQ
FT                   KYIRGLFCGGTLCDETMFAVMEKHGDVYSNIQPDPEFRLKDINRSIKHTFLDFGDDDFT
FT                   NGKPHPMIDPTNRISRLIEEARDPEVAVIVMDFVLGFGSHEDPVGSTIETIKEAKAIAA
FT                   AEGRELIILAYVLGTDLDTPSLEQQSQMLLDAGVILASSSTNTGLLAREFICKGEEA"
     MSVKIVIKPN TYFDSVSLMS ISTRANKLDG VEQAFVAMAT EMNKGVLKNL GLLTPELEQA        60
     KNGDLMIVIN GKSGADNEQL LVEIEELFNT KAQSGSHEAR YATIGSAKKH IPESNLAVIS       120
     VNGLFAAREA RQALQNDLNV MLFSDNVSVE DELALKQLAH EKGLLMMGPD CGTAIINGAA       180
     LCFGNAVRRG NIGIVGASGT GSQELSVRIH EFGGGVSQLI GTGGRDLSEK IGGLMMLDAI       240
     GMLENDPQTE IIALISKPPA PAVARKVLER ARACRKPVVV CFLDRGETPV DEQGLQFARG       300
     TKEAALKAVM LSGVKQENLD LHTLNQPLIA DVRARLQPQQ KYIRGLFCGG TLCDETMFAV       360
     MEKHGDVYSN IQPDPEFRLK DINRSIKHTF LDFGDDDFTN GKPHPMIDPT NRISRLIEEA       420
     RDPEVAVIVM DFVLGFGSHE DPVGSTIETI KEAKAIAAAE GRELIILAYV LGTDLDTPSL       480
     EQQSQMLLDA GVILASSSTN TGLLAREFIC KGEEA                                  515
//

If you have problems or comments...

PBIL Back to PBIL home page