(data stored in ACNUC7421 zone)

EMBL: CP000948.YAIE

CP000948.YAIE        Location/Qualifiers
FT   CDS             346732..347016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiE"
FT                   /locus_tag="ECDH10B_0348"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01520"
FT                   /db_xref="GOA:B1XEY0"
FT                   /db_xref="InterPro:IPR009664"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XEY0"
FT                   /protein_id="ACB01520.1"
FT                   /translation="MLQSNEYFSGKVKSIGFSSSSTGRASVGVMVEGEYTFSTAEPEEM
FT                   TVISGALNVLLPDATDWQVYEAGSVFNVPGHSEFHLQVAEPTSYLCRYL"
     MLQSNEYFSG KVKSIGFSSS STGRASVGVM VEGEYTFSTA EPEEMTVISG ALNVLLPDAT        60
     DWQVYEAGSV FNVPGHSEFH LQVAEPTSYL CRYL                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page