(data stored in ACNUC7421 zone)

EMBL: CP000948.YAII

CP000948.YAII        Location/Qualifiers
FT   CDS             344319..344777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiI"
FT                   /locus_tag="ECDH10B_0344"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01516"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XEX6"
FT                   /protein_id="ACB01516.1"
FT                   /translation="MTIWVDADACPNVIKEILYRAAERMQMPLVLVANQSLRVPPSRFI
FT                   RTLRVAAGFDVADNEIVRQCEAGDLVITADIPLAAEAIEKGAAALNPRGERYTPATIRE
FT                   RLTMRDFMDTLRASGIQTGGPDSLSQRDRQAFAAELEKWWLEVQRSRG"
     MTIWVDADAC PNVIKEILYR AAERMQMPLV LVANQSLRVP PSRFIRTLRV AAGFDVADNE        60
     IVRQCEAGDL VITADIPLAA EAIEKGAAAL NPRGERYTPA TIRERLTMRD FMDTLRASGI       120
     QTGGPDSLSQ RDRQAFAAEL EKWWLEVQRS RG                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page