(data stored in ACNUC7421 zone)

EMBL: CP000948.YAIL

CP000948.YAIL        Location/Qualifiers
FT   CDS             315327..315866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiL"
FT                   /locus_tag="ECDH10B_0309"
FT                   /product="nucleoprotein/polynucleotide-associated enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01487"
FT                   /protein_id="ACB01487.1"
FT                   /translation="MAKLTLQEQLLKAGLVTSKKAAKVERTAKKSRVQAREARAAVEEN
FT                   KKAQLERDKQLSEQQKQAALAKEYKAQVKQLIEMNRITIANGDIGFNFTDGNLIKKIFV
FT                   DKLTQAQLINGRLAIARLLVDNNSEGEYAIIPASVADKIAQRDASSIVLHSALSAEEQD
FT                   EDDPYADFKVPDDLMW"
     MAKLTLQEQL LKAGLVTSKK AAKVERTAKK SRVQAREARA AVEENKKAQL ERDKQLSEQQ        60
     KQAALAKEYK AQVKQLIEMN RITIANGDIG FNFTDGNLIK KIFVDKLTQA QLINGRLAIA       120
     RLLVDNNSEG EYAIIPASVA DKIAQRDASS IVLHSALSAE EQDEDDPYAD FKVPDDLMW        179
//

If you have problems or comments...

PBIL Back to PBIL home page