(data stored in ACNUC7421 zone)

EMBL: CP000948.YAIS

CP000948.YAIS        Location/Qualifiers
FT   CDS             complement(322614..323171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiS"
FT                   /locus_tag="ECDH10B_0320"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01495"
FT                   /protein_id="ACB01495.1"
FT                   /translation="MDKVLDSALLSSANKRKGILAIGAHPDDIELGCGASLARLAQKGI
FT                   YIAAVVMTTGNSGTDGIIDRHEESRNALKILGCHQTIHLNFADTRAHLQLNDMISALED
FT                   IIKNQIPSDVEIMRVYTMHDADRHQDHLAVYQASMVACRTIPQILGYETPSTWLSFMPQ
FT                   VFESVKEEYFTVKLAALKKHKS"
     MDKVLDSALL SSANKRKGIL AIGAHPDDIE LGCGASLARL AQKGIYIAAV VMTTGNSGTD        60
     GIIDRHEESR NALKILGCHQ TIHLNFADTR AHLQLNDMIS ALEDIIKNQI PSDVEIMRVY       120
     TMHDADRHQD HLAVYQASMV ACRTIPQILG YETPSTWLSF MPQVFESVKE EYFTVKLAAL       180
     KKHKS                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page