(data stored in ACNUC7421 zone)

EMBL: CP000948.YAIZ

CP000948.YAIZ        Location/Qualifiers
FT   CDS             338148..338360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiZ"
FT                   /locus_tag="ECDH10B_0337"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01509"
FT                   /protein_id="ACB01509.1"
FT                   /translation="MNLPVKIRRDWHYYAFAIGLIFILNGVVGLLGFEAKGWQTYAVGL
FT                   VTWVISFWLAGLIIRRRDEETENAQ"
     MNLPVKIRRD WHYYAFAIGL IFILNGVVGL LGFEAKGWQT YAVGLVTWVI SFWLAGLIIR        60
     RRDEETENAQ                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page